PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010912730.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family NAC
Protein Properties Length: 337aa    MW: 38046.1 Da    PI: 9.2983
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010912730.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM159.61.2e-49231482128
             NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskk 96 
                     +pGfrFhPt+eel+ +yL++kvegk++++ e i+ +d+y+++Pw+Lp+ ++ +e+ew+f+++rd+ky++g+r+nr+t+sgyWkatg dk + s++
  XP_010912730.1  23 MPGFRFHPTEEELIEFYLRRKVEGKRFNV-ELITFLDLYRYDPWELPAFATIGEREWFFYVPRDRKYRNGDRPNRVTTSGYWKATGADKMIRSEN 116
                     79***************************.89***************8777899***************************************** PP

             NAM  97 gelvglkktLvfykgrapkgektdWvmheyrl 128
                     ++ +glkktLvfy g+apkg +t+W+m+eyrl
  XP_010912730.1 117 SRPIGLKKTLVFYFGKAPKGIRTSWIMNEYRL 148
                     ******************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100555.322169IPR003441NAC domain
SuperFamilySSF1019414.32E-5622169IPR003441NAC domain
PfamPF023658.0E-2524148IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 337 aa     Download sequence    Send to blast
MAIPAAMSGG NGEKYGHEHD IVMPGFRFHP TEEELIEFYL RRKVEGKRFN VELITFLDLY  60
RYDPWELPAF ATIGEREWFF YVPRDRKYRN GDRPNRVTTS GYWKATGADK MIRSENSRPI  120
GLKKTLVFYF GKAPKGIRTS WIMNEYRLPP DETDRNQKAE ISLCRVYKRG GVEDRFSGMH  180
RPSPSKATGP DKKHKDNHHP STFFTTPTGD SSSSEIKKIH EVGVCGSTDD ISVYSTTAPL  240
LNMTASLEDG ISLNSSSTLV STGTLLPSVS SPIATPTASE FNKMVGYHQV YLNLTNQLVQ  300
VAPQPRLPMP NSLATISDKL WAWNPLHEAG KDFTNFK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A3e-552416919165NO APICAL MERISTEM PROTEIN
1ut4_B3e-552416919165NO APICAL MERISTEM PROTEIN
1ut7_A3e-552416919165NO APICAL MERISTEM PROTEIN
1ut7_B3e-552416919165NO APICAL MERISTEM PROTEIN
4dul_A3e-552416919165NAC domain-containing protein 19
4dul_B3e-552416919165NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010912730.10.0PREDICTED: protein ATAF2-like
TrEMBLM0SGN51e-144M0SGN5_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr3P21690_0011e-144(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP28263787
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02450.21e-101NAC domain containing protein 35